Switch #:
SWTI000568
Switch type:
Binary
Switch subtype:
Pre-translational

Description:
Alternative splicing removes the mitochondrial localisation signal (MLS) motif of tRNA dimethylallyltransferase, mitochondrial (Trit1), abrogating binding to Mitochondrial import receptor subunit TOM70 (TOMM70A). The IPPT-I isoform (also known as Isoform 1 of tRNA dimethylallyltransferase, mitochondrial (Trit1)) was found to localise to both the mitochondria and the cytosol whereas the IPPT-II isoform (also known as Isoform 2 of tRNA dimethylallyltransferase, mitochondrial (Trit1)) is only localised to the cytosol and the nucleus. No nuclear localisation signal (NLS) was identified in either splice variant.

Participants:
(1) tRNA dimethylallyltransferase, mitochondrial (Trit1)
(2) Mitochondrial import receptor subunit TOM70 (TOMM70A)

Interactions
Interaction #1 Trit1 - TOMM70A

Interfaces
(1) ELM:TRG_MLS motif (1MAAAAAARAVPVSSGFRGLRRTLPLVVILGATGTGKSTLALQLGQRL47) in tRNA dimethylallyltransferase, mitochondrial (Trit1)
(2) Tetratricopeptide repeat (114-578) in Mitochondrial import receptor subunit TOM70 (TOMM70A)

Interaction Regulation
Alternative splicing Abrogation of the tRNA dimethylallyltransferase, mitochondrial (Trit1) TRG_MLS motif - Mitochondrial import receptor subunit TOM70 (TOMM70A) Tetratricopeptide repeat interaction

References

(1) Subcellular locations of MOD5 proteins: mapping of sequences sufficient for targeting to mitochondria and demonstration that mitochondrial and nuclear isoforms commingle in the cytosol.
Boguta et al. Mol. Cell. Biol. (1994)




Loading visualisation